PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC17735_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 195aa    MW: 21244.6 Da    PI: 9.1903
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC17735_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.15.4e-403190362
       zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                 +++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn k+s
  RrC17735_p1 31 QEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNAKRS 90
                 7899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.0E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3943488IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-243482IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MQDPAAYYQS MMAKQLHQQQ QQQQQPQFPD QEQLKCPRCD SPNTKFCYYN NYNLSQPRHF  60
CKSCRRYWTK GGALRNVPVG GGSRKNAKRS TSSSTSPNSH KKAKTPDPDP SSQKETNPDT  120
DPTRMLYGFP IGDQDVKGME MGVGVGGGGG SFSSLLASNM QLGLGGIMLD GSGWDPGMSL  180
GLRRSEAGNG GGDFH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406292.12e-99hypothetical protein EUTSA_v10021538mg
SwissprotQ94AR62e-81DOF31_ARATH; Dof zinc finger protein DOF3.1
TrEMBLV4LBD43e-99V4LBD4_EUTSA; Uncharacterized protein
STRINGBra001822.1-P2e-94(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.11e-71DOF zinc finger protein 2